PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013583909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 250aa    MW: 28517.6 Da    PI: 5.1823
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013583909.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013583909.1 14 KGPWSAEEDRILISHIRLHGHPNWRALPQLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.17.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
   XP_013583909.1  67 RGNFTPQEEETIINLHQSLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.221961IPR017930Myb domain
SuperFamilySSF466892.71E-2910108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001671.04E-91661No hitNo description
PROSITE profilePS5129424.90362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2765116IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.42E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRRPCCEKM GLKKGPWSAE EDRILISHIR LHGHPNWRAL PQLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPQEEETIIN LHQSLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRIQHNQ  120
DQNISETICD NDEQLVSVMD EKRPSSPQQQ SSSSTNISAV TTSSNNNDVS NNNIKDSATS  180
PEDVLPLIDE SFWSEVVSMD YNISGDEEIK IEDWESSLDS NIKGYNHDME SWFDNLLTSN  240
LTTGENSDIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00127DAPTransfer from AT1G06180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382790.0KF738279.1 Brassica napus MYB transcription factor 13 (MYB13.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013583909.10.0PREDICTED: myb-related protein Myb4
RefseqNP_001302971.10.0myb-related protein Myb4-like
TrEMBLA0A078FAV90.0A0A078FAV9_BRANA; BnaC05g04250D protein
TrEMBLA0A0D3C8140.0A0A0D3C814_BRAOL; Uncharacterized protein
STRINGBra015481.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.11e-116myb domain protein 13